PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma106g00500.1
Common NameZOSMA_106G00500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24540.2 Da    PI: 9.4544
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma106g00500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.42.1e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien s rqvtfskRr+g++KKA+ELSvLCdaev +i+fs++gklye+ss
  Zosma106g00500.1  9 KRIENASSRQVTFSKRRTGLIKKAYELSVLCDAEVGLIVFSPRGKLYEFSS 59
                      79***********************************************96 PP

2K-box57.27.1e-2083175798
             K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       +++  ++ ++++ e+a++ k+i+ L+ + R+llGe ++ + s +eLqq+e+qLeksl++iR kK++++  +i++l++kek+l een++ + +l
  Zosma106g00500.1  83 SKQPPQDLNQWKYEVAQMGKQIDLLEISRRKLLGEeEVMTSSSEELQQIENQLEKSLRNIRLKKTQYIECEIQQLKEKEKMLLEENQYYKVQL 175
                       4466678899************************7369999**********************************************988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.118161IPR002100Transcription factor, MADS-box
CDDcd002653.40E-39377No hitNo description
SuperFamilySSF554555.76E-31383IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-30323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.9E-2089170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.48890181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVRGKTQMKR IENASSRQVT FSKRRTGLIK KAYELSVLCD AEVGLIVFSP RGKLYEFSST  60
ACLQKTIERY INHTKEQNGY SSSKQPPQDL NQWKYEVAQM GKQIDLLEIS RRKLLGEEEV  120
MTSSSEELQQ IENQLEKSLR NIRLKKTQYI ECEIQQLKEK EKMLLEENQY YKVQLMKLQK  180
QPEIKRESED LKPEKPPSDV TTWLCIGRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-17383281Myocyte-specific enhancer factor 2A
3kov_B3e-17383281Myocyte-specific enhancer factor 2A
3kov_I3e-17383281Myocyte-specific enhancer factor 2A
3kov_J3e-17383281Myocyte-specific enhancer factor 2A
3mu6_A2e-17373271Myocyte-specific enhancer factor 2A
3mu6_B2e-17373271Myocyte-specific enhancer factor 2A
3mu6_C2e-17373271Myocyte-specific enhancer factor 2A
3mu6_D2e-17373271Myocyte-specific enhancer factor 2A
3p57_A3e-17383281Myocyte-specific enhancer factor 2A
3p57_B3e-17383281Myocyte-specific enhancer factor 2A
3p57_C3e-17383281Myocyte-specific enhancer factor 2A
3p57_D3e-17383281Myocyte-specific enhancer factor 2A
3p57_I3e-17383281Myocyte-specific enhancer factor 2A
3p57_J3e-17383281Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255589.11e-66PREDICTED: MADS-box protein SOC1
RefseqXP_010255590.11e-66PREDICTED: MADS-box protein SOC1
SwissprotO646456e-63SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A0K9Q4Q61e-151A0A0K9Q4Q6_Z
STRINGGLYMA07G08831.17e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-58AGAMOUS-like 20